PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G182100.1
Common NamePHAVU_003G182100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Dof
Protein Properties Length: 288aa    MW: 30942.1 Da    PI: 7.0223
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G182100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.4e-393999262
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk+k+s+
  Phvul.003G182100.1 39 NHQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSN 99
                        57899****************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-283797IPR003851Zinc finger, Dof-type
PfamPF027012.0E-334197IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.734397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MQQIHSMAPG TGGGGAGGGP RFFSATATAD RRLRPHHQNH QALKCPRCDS LNTKFCYYNN  60
YNLSQPRHFC KNCRRYWTKG GVLRNVPVGG GCRKSKRSNK PAKTSDTAPP PPLPDPDHSS  120
SESSSLTAAA AEPVSAPINS DSTNVQESKL LVPADPVLET NPLEQGAGDC GGIFSEIGPF  180
TSLIATSTNE PLAFGFGNAL PDASSFQWQN SKVTSNQELK LPESSFLDHT VDLTTMHGKT  240
SHGTFGSLDW QGGADQGLFD LPNTVDHAYW SHTHWSDHDN SSLFHLP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155202.10.0hypothetical protein PHAVU_003G182100g
SwissprotQ8LDR01e-59DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLV7CE950.0V7CE95_PHAVU; Uncharacterized protein
STRINGGLYMA05G07460.11e-127(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.12e-55OBF binding protein 4